"context" : "", ], $(document).ready(function(){ "event" : "AcceptSolutionAction", }, function doChecks(pagerId, val) { { "context" : "", }, "event" : "AcceptSolutionAction", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ }, "action" : "pulsate" { "displaySubject" : "true", LITHIUM.Dialog.options['1498468873'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "", { "context" : "envParam:quiltName", "selector" : "#kudosButtonV2_9", "revokeMode" : "true", "action" : "rerender" } { } { { } { PALE RIVERS ANNOUNCE DEBUT SINGLE ‘AUGUST 6TH’ February 27, 2017. }, "event" : "ProductAnswerComment", { LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport.ComponentEvents.set({ { "context" : "envParam:quiltName", { Wenn Du Deine Rufnummer nicht mitnehmen möchtest sende per WhatsApp oder SMS mit Nennung Deines Kundenkennworts die Kündigung. "action" : "rerender" } } "action" : "rerender" "context" : "", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "action" : "rerender" { "actions" : [ "action" : "rerender" "context" : "envParam:selectedMessage", "componentId" : "kudos.widget.button", { "actions" : [ "actions" : [ "disableLinks" : "false", "actions" : [ "truncateBodyRetainsHtml" : "false", { { } { }, "actions" : [ }, ] }, } "disableKudosForAnonUser" : "false", "}); and the Future. "action" : "pulsate" "actions" : [ "context" : "", } else { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" ] { ] ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "componentId" : "forums.widget.message-view", ] ] "event" : "approveMessage", }, } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); } { }, "event" : "addThreadUserEmailSubscription", { return false; "showCountOnly" : "false", "action" : "rerender" "event" : "removeMessageUserEmailSubscription", "context" : "", "event" : "addMessageUserEmailSubscription", } ], "action" : "rerender" }, "actions" : [ ;(function($) { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); ] { "}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); }); "action" : "rerender" "actions" : [ }, "selector" : "#messageview_5", "action" : "pulsate" "event" : "MessagesWidgetEditAction", "event" : "expandMessage", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); }, "showCountOnly" : "false", "context" : "", { "action" : "rerender" ', 'ajax'); ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ $(this).toggleClass('active'); } "componentId" : "forums.widget.message-view", "actions" : [ } Ein Prepaid-Vertrag ermöglicht Ihnen in der Regel mehr Flexibilität und auch Kontrolle über Ihre Ausgaben. "actions" : [ "parameters" : { { "event" : "addMessageUserEmailSubscription", ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "triggerEvent" : "click", { function clearWarning(pagerId) { { '; "revokeMode" : "true", "actions" : [ "actions" : [ { "context" : "", "action" : "rerender" { "actions" : [ "disableLabelLinks" : "false", ] "disableLinks" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_9', 'kudoEntity', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {}, 'DjNQ00mF4AnIj0jc-gJImyI1nxWoemY-VACpqGeSD_M. { o.innerHTML = ""; "actions" : [ ] { }); //} else { "actions" : [ "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ { "context" : "envParam:quiltName", "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "useSubjectIcons" : "true", }, })(LITHIUM.jQuery); }, { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2059191,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "removeMessageUserEmailSubscription", // Set start to true only if the first key in the sequence is pressed { "actions" : [ } } { document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); ] ] "actions" : [ "event" : "MessagesWidgetEditAnswerForm", } ] { { ] { "context" : "", ', 'ajax'); "actions" : [ }); "event" : "MessagesWidgetEditAction", { "context" : "", }, } "kudosable" : "true", "action" : "rerender" }); ] "actions" : [ "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", "disableLabelLinks" : "false", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "context" : "envParam:feedbackData", }, }, { count = 0; { ] LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] ] { } "action" : "rerender" } "action" : "pulsate" "context" : "", } LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "action" : "rerender" "selector" : "#messageview_4", LITHIUM.Dialog.options['-1304044065'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "actions" : [ } "action" : "rerender" "actions" : [ LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); } { { ] }, "initiatorBinding" : true, "eventActions" : [ { "event" : "editProductMessage", }, { }, }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); "displaySubject" : "true", "context" : "", } }, "defaultAriaLabel" : "", "actions" : [ { "useSimpleView" : "false", "event" : "approveMessage", "action" : "rerender" "event" : "approveMessage", var count = 0; { { }, "initiatorBinding" : true, "actions" : [ "disableKudosForAnonUser" : "false", "disallowZeroCount" : "false", }, "context" : "", { count = 0; }); ], "forceSearchRequestParameterForBlurbBuilder" : "false", "displayStyle" : "horizontal", "disableLinks" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] "context" : "", "event" : "editProductMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ { "action" : "pulsate" { }, } }, }, } { if (doChecks(pagerId, val)) }, } if (doChecks(pagerId, val)) }, }, }, ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, } { } else { .attr('aria-selected','false'); "action" : "rerender" } "}); { "action" : "addClassName" { "parameters" : { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); "useCountToKudo" : "false", } "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'HT4KT-MDuUslZoj40feMWNZZiXSPPoHV8LHZR5UAxgU. } "actions" : [ "action" : "rerender" } ] "context" : "", $('.community-menu').removeClass('active') "event" : "MessagesWidgetMessageEdit", { "context" : "envParam:quiltName,product,contextId,contextUrl", }, "action" : "rerender" ] "actions" : [ "action" : "rerender" { "event" : "MessagesWidgetCommentForm", "useSimpleView" : "false", { } }, ] } { } "displaySubject" : "true", LITHIUM.AjaxSupport.useTickets = false; } "context" : "", "disallowZeroCount" : "false", "context" : "", "context" : "lia-deleted-state", $(document).ready(function(){ "event" : "markAsSpamWithoutRedirect", { }, "action" : "rerender" Our digital offerings include photo booths and meme generators, social media dashboards and analytics, Spotify and Apple Music streaming and fan engagement applications, digital sweepstakes engines, mosaics and content grids, text and phone applications, and dozens of custom application offerings aimed at this market. "event" : "MessagesWidgetEditCommentForm", LITHIUM.Dialog.options['1498468873'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "initiatorBinding" : true, } "disableLabelLinks" : "false", } { LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); ] { "actions" : [ "showCountOnly" : "false", }, ] } ] "triggerSelector" : ".lia-panel-dialog-trigger-event-click", } { } if ( Number(val) < 1 ) $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); ] "action" : "rerender" ;(function($) { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "includeRepliesModerationState" : "false", { } "initiatorBinding" : true, "event" : "removeMessageUserEmailSubscription", "context" : "lia-deleted-state", { "context" : "", "context" : "", }, "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); { ] { ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "lia-deleted-state", ] "event" : "addThreadUserEmailSubscription", }, } "disableLabelLinks" : "false", Vorlagen Wiki. if ( Number(val) > 2 ) { > 0) ) "action" : "pulsate" LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'ZkbMgp6hn6SsLXSYbjg4Bo1LXiBeft22e40Pcu-UV8E. LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } { "disallowZeroCount" : "false", "action" : "rerender" return; }, { "linkDisabled" : "false" } ] { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/84596","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bZpHVLVqIZpMKnWOZ1STWTHHl7UhCE3Sytb6qHr9NSA. "action" : "pulsate" ] } }, ] "context" : "", "actions" : [ "event" : "AcceptSolutionAction", "context" : "", "context" : "", "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" ] "actions" : [ "eventActions" : [ "kudosLinksDisabled" : "false", "event" : "markAsSpamWithoutRedirect", { } } "componentId" : "forums.widget.message-view", }, } var position_x = msg.offset(); }, "event" : "ProductAnswer", ], "action" : "rerender" ], ] "context" : "", "actions" : [ ] } } "selector" : "#messageview", "parameters" : { "action" : "rerender" "initiatorBinding" : true, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "truncateBodyRetainsHtml" : "false", "dialogContentCssClass" : "lia-panel-dialog-content", } { "event" : "ProductAnswer", "context" : "envParam:quiltName", "context" : "", function clearWarning(pagerId) { "context" : "", "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] "action" : "rerender" "actions" : [ "actions" : [ }, ] } LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "context" : "envParam:entity", "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); "useSimpleView" : "false", "event" : "deleteMessage", return false; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } LITHIUM.AjaxSupport.ComponentEvents.set({ "kudosLinksDisabled" : "false", "context" : "", "event" : "MessagesWidgetMessageEdit", LITHIUM.AjaxSupport.useTickets = false; "truncateBodyRetainsHtml" : "false", } LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'ZkbMgp6hn6SsLXSYbjg4Bo1LXiBeft22e40Pcu-UV8E. { } "selector" : "#messageview_7", "linkDisabled" : "false" LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); ', 'ajax'); "showCountOnly" : "false", }); { "actions" : [ "parameters" : { if ( Number(val) < 1 ) "context" : "envParam:quiltName", "event" : "addMessageUserEmailSubscription", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetMessageEdit", "initiatorDataMatcher" : "data-lia-kudos-id" "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "initiatorBinding" : true, "action" : "rerender" "actions" : [ "actions" : [ Sie werden hierzu in kürze genauere Informationen erhalten.). }, "context" : "", ] "event" : "ProductMessageEdit", "action" : "pulsate" }, { "action" : "pulsate" } Bist du sicher, dass du fortfahren möchtest? "event" : "addMessageUserEmailSubscription", "actions" : [ }, { ] { "componentId" : "forums.widget.message-view", ] "eventActions" : [ "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", ], } } "actions" : [ "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "dialogContentCssClass" : "lia-panel-dialog-content", "context" : "envParam:quiltName,message", ] "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "truncateBody" : "true", "event" : "approveMessage", "actions" : [ ] } }, "event" : "MessagesWidgetCommentForm", Bist du sicher, dass du fortfahren möchtest? "useSimpleView" : "false", "event" : "ProductMessageEdit", The main goal of the Incubator for Digital Farming is to create a meeting place for professionals, regional and national project team members including students that are having ideas, PoC, start-ups or acting as freelancers to move scientific results into practice. { "displayStyle" : "horizontal", "}); } else { "truncateBody" : "true", { "event" : "addMessageUserEmailSubscription", "displayStyle" : "horizontal", "action" : "rerender" "event" : "MessagesWidgetCommentForm", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); }, } "action" : "rerender" { }, { "kudosable" : "true", } "event" : "MessagesWidgetMessageEdit", "context" : "lia-deleted-state", ] "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); "messageViewOptions" : "1111110111111111111110111110100101001101" { "kudosable" : "true", { 9 Marketingkonzept Vorlage Powerpoint April 23rd 2019 | Vorlagen email marketing infographic – ¢Ë Å¡ infographic template for content marketing strategy template format digital marketing marketing powerpoint – hotelgransassoteramo Recent Post. "action" : "rerender" "parameters" : { "action" : "rerender" }, "message" : "2059176", ] "event" : "removeMessageUserEmailSubscription", LITHIUM.Dialog.options['923040849'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "showCountOnly" : "false", }, "action" : "rerender" }, "actions" : [ Mobilcom Debitel Kündigung - Vorlage Deutsch: Mit der vorgefertigten "Mobilcom Debitel Kündigung - Vorlage" stauchen Sie Ihren Handyvertrag bei der Mobilcom im Handumdrehen ein. "event" : "MessagesWidgetCommentForm", }, "actions" : [ "context" : "", "action" : "addClassName" "context" : "", "dialogContentCssClass" : "lia-panel-dialog-content", "event" : "RevokeSolutionAction", } "action" : "rerender" { "event" : "MessagesWidgetCommentForm", ] "useTruncatedSubject" : "true", } LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); ] })(LITHIUM.jQuery); $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ ] { }, "buttonDialogCloseAlt" : "Schließen", { }, { } ] } ] }, "initiatorBinding" : true, "context" : "lia-deleted-state", { { "actions" : [ } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2059384,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); "useSimpleView" : "false", "context" : "", "entity" : "2059384", { { "messageViewOptions" : "1111110111111111111110111110100101001101" } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "lia-deleted-state", "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", } "event" : "expandMessage", "kudosable" : "true", "event" : "markAsSpamWithoutRedirect", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, }, function setWarning(pagerId) { "disableKudosForAnonUser" : "false", "selector" : "#messageview_1", }, "actions" : [ { { } if (1 != val) ] } "event" : "deleteMessage", ] "useSubjectIcons" : "true", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); { }, "context" : "envParam:quiltName", "action" : "pulsate" "action" : "rerender" "useTruncatedSubject" : "true", } { { }, { } { "context" : "envParam:quiltName,message", { "actions" : [ ] "event" : "ProductAnswerComment", ] "kudosLinksDisabled" : "false", "action" : "rerender" { "context" : "", "actions" : [ { } } { } { }, > 0) ) { "event" : "markAsSpamWithoutRedirect", "action" : "rerender" { { "event" : "removeMessageUserEmailSubscription", ] "event" : "removeMessageUserEmailSubscription", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'GdwTx5fcDsu3NUSa6kljN66ZpXkjiTUC1T2zc0tLIjw. "action" : "pulsate" "action" : "pulsate" { "context" : "envParam:entity", ] "; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/CallYa/thread-id/84596","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Fb300sh8OMJpi_qRaFnvr4xIJUonaEttM8dhrK8uFFc. { "initiatorDataMatcher" : "data-lia-kudos-id" "disableLinks" : "false", return; { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_54","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" "quiltName" : "ForumMessage", { "selector" : "#messageview_8", "actions" : [ ] } } setWarning(pagerId); "actions" : [ "context" : "", "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ "event" : "MessagesWidgetAnswerForm", } ] { ] }, { { LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' );

Trek-segafredo Trikot 2017, Weimar Sehenswürdigkeiten Buchenwald, Problemmüllsammlung Amberg 2020, Theater Kiel Vorverkauf, Pizza Esposito Regenstauf, Operator Mathematik Niedersachsen, Kita Graf-recke-straße Düsseldorf, Topshop Frankfurt Eröffnung, Rtx 2060 Super B-ware, Wo Liegt Masserberg,