{ "actions" : [ "context" : "", }, "action" : "pulsate" "event" : "MessagesWidgetAnswerForm", "quiltName" : "ForumMessage", "action" : "rerender" "defaultAriaLabel" : "", } "event" : "AcceptSolutionAction", "event" : "QuickReply", ] "selector" : "#kudosButtonV2_6", { }, ] "action" : "rerender" "actions" : [ }, "linkDisabled" : "false" ] "event" : "MessagesWidgetCommentForm", "context" : "envParam:quiltName,product,contextId,contextUrl", } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.Dialog.options['-1747896537'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }); }, "context" : "envParam:quiltName,product,contextId,contextUrl", "parameters" : { "event" : "MessagesWidgetMessageEdit", ], { "action" : "rerender" } }, "disableKudosForAnonUser" : "false", if (element.hasClass('active')) { "event" : "MessagesWidgetMessageEdit", "buttonDialogCloseAlt" : "Schließen", "actions" : [ "event" : "kudoEntity", "defaultAriaLabel" : "", "selector" : "#messageview_8", "accessibility" : false, }, { ] LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "parameters" : { "action" : "rerender" "context" : "envParam:selectedMessage", "context" : "", 100-200 kbps). "action" : "rerender" { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "kudosLinksDisabled" : "false", }, } ] LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "action" : "pulsate" "quiltName" : "ForumMessage", } "event" : "unapproveMessage", ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); LITHIUM.Dialog.options['1516236485'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" LITHIUM.Dialog.options['283186019'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "context" : "", function disableInput(pagerId) { ] LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:refresh_attachment_statuses","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#attachments_0_721cef6411c165","action":"refresh_attachment_statuses","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.attachments_0:refresh_attachment_statuses?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/73389&t:cp=messages/contributions/messageviewparameterscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"eU518LOc2O5oo8C7eaKAcUfz6Rd5vd5aqzIdM8w5Lxk. "componentId" : "kudos.widget.button", "event" : "MessagesWidgetCommentForm", "event" : "ProductMessageEdit", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); "actions" : [ "actions" : [ { ', 'ajax'); "context" : "envParam:selectedMessage", "parameters" : { "actions" : [ } }, }, "useTruncatedSubject" : "true", "eventActions" : [ }, "event" : "deleteMessage", "eventActions" : [ { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2121361 .lia-rating-control-passive', '#form_4'); "action" : "rerender" { }, "disableLabelLinks" : "false", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", }, { return; LITHIUM.AjaxSupport.ComponentEvents.set({ { "action" : "addClassName" "disableKudosForAnonUser" : "false", "displaySubject" : "true", "actions" : [ { }, } count++; "event" : "AcceptSolutionAction", LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'HcgzUl_IYUx9v3Q7KDKjKGX2AGXXx9SLmV5qfgaoTVg. ] "kudosable" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "truncateBody" : "true", "event" : "addThreadUserEmailSubscription", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditAction", "context" : "envParam:quiltName,expandedQuiltName", var o = document.getElementById("custom_board_pagination_warning" + pagerId); "actions" : [ $('.css-menu').removeClass('cssmenu-open') "action" : "rerender" }, Bist du sicher, dass du fortfahren möchtest? { "useSubjectIcons" : "true", ] } { { "action" : "rerender" ] "event" : "removeThreadUserEmailSubscription", ] { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { ], "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, "includeRepliesModerationState" : "false", "action" : "rerender" }, "action" : "pulsate" { }, { { "action" : "rerender" "displaySubject" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); { }, } { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "initiatorBinding" : true, "context" : "", // Set start to true only if the first key in the sequence is pressed { "disableKudosForAnonUser" : "false", "actions" : [ }, "actions" : [ { { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "addClassName" "context" : "", "actions" : [ "entity" : "2176302", $(document).ready(function(){ { "action" : "rerender" "context" : "envParam:entity", }, } { { } "useSubjectIcons" : "true", "action" : "rerender" { } "action" : "rerender" { "actions" : [ }, "initiatorDataMatcher" : "data-lia-kudos-id" { "actions" : [ "displaySubject" : "true", ] ] "showCountOnly" : "false", "event" : "ProductAnswer", "event" : "approveMessage", "action" : "rerender" { "action" : "rerender" ] "eventActions" : [ "context" : "envParam:quiltName", > 0) ) "action" : "pulsate" ], { "kudosLinksDisabled" : "false", ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ }, ] "includeRepliesModerationState" : "false", "event" : "addMessageUserEmailSubscription", { "event" : "addMessageUserEmailSubscription", "useCountToKudo" : "false", "componentId" : "kudos.widget.button", }, } "kudosLinksDisabled" : "false", LITHIUM.Dialog.options['1532317143'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, function processPageInputBlur(pagerId, val) "truncateBody" : "true", $(document).ready(function(){ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); { "actions" : [ "context" : "", Vodafone-Internet plötzlich langsam. } "context" : "", { "event" : "MessagesWidgetCommentForm", setWarning(pagerId); }, 3. "context" : "", LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'asqFq8pq9ClaKX4oaosZ1x8rA0vl27vVkaYgW1AHD9I. // If watching, pay attention to key presses, looking for right sequence. "selector" : "#kudosButtonV2_8", "context" : "", { }, { "actions" : [ "disableLinks" : "false", LITHIUM.Dialog.options['-248679667'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" }, { "actions" : [ "event" : "markAsSpamWithoutRedirect", logmein: [76, 79, 71, 77, 69, 73, 78], "actions" : [ }); { }, "action" : "rerender" "action" : "rerender" ] { ] ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); })(LITHIUM.jQuery); "}); ;(function($) { }, { "}); }, "actions" : [ } { "context" : "", } "action" : "rerender" "context" : "", "context" : "", $('.lia-button-wrapper-searchForm-action').removeClass('active'); "action" : "rerender" }, { "}); der erbrachten Leistung bin ich momentan absolut unzufrieden. clearWarning(pagerId); ] LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "context" : "", } { "message" : "1821748", "initiatorDataMatcher" : "data-lia-message-uid" } "context" : "envParam:selectedMessage", ] ] ] watching = false; "context" : "envParam:quiltName", "event" : "ProductAnswerComment", ] "action" : "rerender" "componentId" : "forums.widget.message-view", "quiltName" : "ForumMessage", LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "removeMessageUserEmailSubscription", "context" : "envParam:quiltName,product,contextId,contextUrl", ] ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ ] "parameters" : { "action" : "rerender" "actions" : [ o.innerHTML = "Page number can\'t exceed 2. "; "actions" : [ "event" : "approveMessage", "disableLinks" : "false", "context" : "envParam:entity", ;(function($) { { "context" : "", "action" : "rerender" } } "event" : "kudoEntity", "useSimpleView" : "false", ], LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); $(document).keydown(function(e) { "event" : "AcceptSolutionAction", "action" : "rerender" ] "action" : "rerender" ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", // console.log(key); } "initiatorBinding" : true, ] "useSimpleView" : "false", } "event" : "MessagesWidgetEditCommentForm", "parameters" : { createStorage("false"); "context" : "", "truncateBody" : "true", "; { "useSimpleView" : "false", } { }); { }, }, { ] "event" : "markAsSpamWithoutRedirect", function clearWarning(pagerId) { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"});